IL1B

IL1B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1HIB, 1I1B, 1IOB, 1ITB, 1L2H, 1S0L, 1T4Q, 1TOO, 1TP0, 1TWE, 1TWM, 21BI, 2I1B, 2KH2, 2NVH, 31BI, 3O4O, 3POK, 41BI, 4DEP, 4G6J, 4G6M, 4GAI, 4I1B, 5I1B, 6I1B, 7I1B, 9ILB, 4GAF, 5BVP

Ідентифікатори
Символи IL1B, IL-1, IL1-BETA, IL1F2, interleukin 1 beta, IL1beta
Зовнішні ІД OMIM: 147720 MGI: 96543 HomoloGene: 481 GeneCards: IL1B
Онтологія гена
Молекулярна функція

• protein domain specific binding
• interleukin-1 receptor binding
• cytokine activity
• integrin binding
• GO:0001948, GO:0016582 protein binding

Клітинна компонента

• цитоплазма
• гіалоплазма
• extracellular region
• лізосома
• екзосома
• secretory granule
• везикула
• міжклітинний простір

Біологічний процес

• positive regulation of protein phosphorylation
• smooth muscle adaptation
• positive regulation of calcidiol 1-monooxygenase activity
• GO:1903105 negative regulation of insulin receptor signaling pathway
• cellular response to mechanical stimulus
• positive regulation of interleukin-8 production
• positive regulation of mitotic nuclear division
• response to carbohydrate
• embryo implantation
• regulation of I-kappaB kinase/NF-kappaB signaling
• negative regulation of cell population proliferation
• GO:0097285 апоптоз
• cellular response to organic substance
• positive regulation of phagocytosis
• regulation of insulin secretion
• neutrophil chemotaxis
• GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
• positive regulation of protein export from nucleus
• positive regulation of prostaglandin secretion
• positive regulation of myosin light chain kinase activity
• negative regulation of MAP kinase activity
• positive regulation of T cell proliferation
• positive regulation of interleukin-6 production
• inflammatory response
• negative regulation of lipid metabolic process
• sequestering of triglyceride
• hyaluronan biosynthetic process
• positive regulation of heterotypic cell-cell adhesion
• positive regulation of lipid catabolic process
• GO:1904579 cellular response to organic cyclic compound
• positive regulation of fever generation
• positive regulation of DNA-binding transcription factor activity
• positive regulation of angiogenesis
• response to lipopolysaccharide
• positive regulation of NF-kappaB transcription factor activity
• positive regulation of granulocyte macrophage colony-stimulating factor production
• GO:0046730, GO:0046737, GO:0046738, GO:0046736 імунна відповідь
• ectopic germ cell programmed cell death
• leukocyte migration
• lipopolysaccharide-mediated signaling pathway
• positive regulation of vascular endothelial growth factor receptor signaling pathway
• positive regulation of cell adhesion molecule production
• response to ATP
• monocyte aggregation
• protein kinase B signaling
• positive regulation of nitric oxide biosynthetic process
• cell-cell signaling
• positive regulation of monocyte chemotactic protein-1 production
• regulation of nitric-oxide synthase activity
• positive regulation of membrane protein ectodomain proteolysis
• positive regulation of interferon-gamma production
• MAPK cascade
• positive regulation of histone acetylation
• GO:1901313 positive regulation of gene expression
• negative regulation of glucose transmembrane transport
• interleukin-1 beta production
• positive regulation of T cell mediated immunity
• extrinsic apoptotic signaling pathway in absence of ligand
• positive regulation of I-kappaB kinase/NF-kappaB signaling
• positive regulation of vascular endothelial growth factor production
• negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
• negative regulation of lipid catabolic process
• negative regulation of adiponectin secretion
• regulation of establishment of endothelial barrier
• positive regulation of cell division
• GO:0072468 сигнальна трансдукція
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• cytokine-mediated signaling pathway
• regulation of defense response to virus by host
• fever generation
• positive regulation of JNK cascade
• positive regulation of cell population proliferation
• regulation of signaling receptor activity
• positive regulation of epithelial to mesenchymal transition
• positive regulation of cell migration
• interleukin-6 production
• astrocyte activation
• regulation of neurogenesis
• negative regulation of neurogenesis
• negative regulation of synaptic transmission
• positive regulation of glial cell proliferation
• regulation of ERK1 and ERK2 cascade
• interleukin-1-mediated signaling pathway
• cellular response to lipopolysaccharide
• positive regulation of neuroinflammatory response
• positive regulation of p38MAPK cascade
• positive regulation of NIK/NF-kappaB signaling
• positive regulation of T-helper 1 cell cytokine production
• positive regulation of prostaglandin biosynthetic process
• positive regulation of complement activation
• positive regulation of inflammatory response
• response to interleukin-1
• positive regulation of RNA biosynthetic process

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
3553
16176
Ensembl
ENSG00000125538
ENSMUSG00000027398
UniProt
P01584
P10749
RefSeq (мРНК)
NM_000576
NM_008361
RefSeq (білок)
NP_000567
NP_032387
Локус (UCSC) Хр. 2: 112.83 – 112.84 Mb Хр. 2: 129.21 – 129.21 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IL1B (англ. Interleukin 1 beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 269 амінокислот, а молекулярна маса — 30 748[4].

Послідовність амінокислот
1020304050
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
RISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEE
EPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQ
DMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLES
VDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFL
GGTKGGQDITDFTMQFVSS

Кодований геном білок за функціями належить до цитокінів, мітогенів. Задіяний у таких біологічних процесах як запальна відповідь, поліморфізм. Локалізований у цитоплазмі, лізосомі. Також секретований назовні.

Література

  • Clark B.D., Collins K.L., Gandy M.S., Webb A.C., Auron P.E. (1986). Genomic sequence for human prointerleukin 1 beta: possible evolution from a reverse transcribed prointerleukin 1 alpha gene. Nucleic Acids Res. 14: 7897—7914. PMID 3490654 DOI:10.1093/nar/14.20.7897
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Mizutani H., Schechter N., Lazarus G., Black R.A., Kupper T.S. (1991). Rapid and specific conversion of precursor interleukin 1 beta (IL-1 beta) to an active IL-1 species by human mast cell chymase. J. Exp. Med. 174: 821—825. PMID 1919436 DOI:10.1084/jem.174.4.821
  • Nanduri V.B., Hulmes J.D., Pan Y.C., Kilian P.L., Stern A.S. (1991). The role of arginine residues in interleukin 1 receptor binding. Biochim. Biophys. Acta. 1118: 25—35. PMID 1837236 DOI:10.1016/0167-4838(91)90437-5
  • Piccioli P., Rubartelli A. (2013). The secretion of IL-1beta and options for release. Semin. Immunol. 25: 425—429. PMID 24201029 DOI:10.1016/j.smim.2013.10.007
  • Priestle J.P., Schar H.-P., Gruetter M.G. (1989). Crystallographic refinement of interleukin 1 beta at 2.0-A resolution. Proc. Natl. Acad. Sci. U.S.A. 86: 9667—9671. PMID 2602367 DOI:10.1073/pnas.86.24.9667

Примітки

  1. ↑ Human PubMed Reference:.
  2. ↑ Mouse PubMed Reference:.
  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:5992 (англ.) . Процитовано 28 серпня 2017.
  4. ↑ UniProt, P01584 (англ.) . Архів оригіналу за 20 серпня 2017. Процитовано 28 серпня 2017.

Див. також

  • Хромосома 2

П:  Портал «Біологія» П:  Портал «Хімія»


Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.